PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G183400.1
Common NamePHAVU_002G183400g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family M-type_MADS
Protein Properties Length: 330aa    MW: 37878.8 Da    PI: 7.9313
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G183400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF51.99.8e-171151343
                        --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
              SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                        ie +  r++tf kR+ng++KK +E S+LC ++v viif+s+
  Phvul.002G183400.1 11 IEKEKARKTTFQKRKNGLMKKVYEFSTLCSVDVGVIIFASK 51
                        899999********************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006620.184151IPR002100Transcription factor, MADS-box
SMARTSM004327.2E-19161IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.32E-20290IPR002100Transcription factor, MADS-box
CDDcd001205.80E-21251No hitNo description
PRINTSPR004041.1E-10323IPR002100Transcription factor, MADS-box
PfamPF003191.3E-181149IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-102338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-103859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MGRGRIPMDL IEKEKARKTT FQKRKNGLMK KVYEFSTLCS VDVGVIIFAS KFLDEPEIWP  60
QDPRKLKCVI EKYLNTTSDR RPKVYDVEEY FSERMKRIEG DISKVQKGKI QLMYPTWDDS  120
YDALGEEQLR MFVSILDSKL DVCTQRMNML KQDSNGKAIV ELVKDEAGVP YMAQNLGSHL  180
NFMQNMSQTQ VFPPNDNSQV PFYPFHLSQN VPSLFQLGQN FRQLMEKNGT VDWGNQVGAS  240
DDHKMGTQQE NGSDKNQNSS SSCYYNGNMQ TMQAYNNGAL QTLPSQLQFD ATFQTLSNRP  300
GPPRGFDPNG YDDSNMLQPQ FLNYMHRRK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007158806.10.0hypothetical protein PHAVU_002G183400g
TrEMBLV7CNI10.0V7CNI1_PHAVU; Uncharacterized protein
STRINGGLYMA05G27105.11e-134(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.14e-25M-type_MADS family protein